PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV27284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ARF
Protein Properties Length: 511aa    MW: 56886.5 Da    PI: 9.2083
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV27284.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.92.4e-1032745498
                EETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
          B3 54 kksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                 +++r++lt+GW+ Fv+a++L +gD ++F   + +++ l+v+v+r
  KZV27284.1 32 SQPRRHLLTTGWSVFVSAKKLVAGDAFIFL--RGENGDLRVGVRR 74
                46789*************************..3488889***997 PP

2Auxin_resp105.65.8e-35100182183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+st++ F+v+Y+Pr+s+seF+v+++k+++a ++k+svGmRf+m+fe+e+s+  r+sGt+vg  + +++ Wp+S+WrsLk
  KZV27284.1 100 ASHAISTRTRFSVFYKPRTSRSEFIVSLNKYLEARNRKLSVGMRFRMMFEGEESAMYRFSGTIVGAGENSSSTWPDSEWRSLK 182
                 789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.079176IPR003340B3 DNA binding domain
CDDcd100171.33E-72974No hitNo description
SuperFamilySSF1019367.32E-1131103IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-143288IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-73274IPR003340B3 DNA binding domain
PfamPF065077.3E-33100182IPR010525Auxin response factor
PfamPF023099.2E-12386479IPR033389AUX/IAA domain
PROSITE profilePS5174521.517388481IPR000270PB1 domain
SuperFamilySSF542773.07E-11391466No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MKNIVFRELY KKASFNLYIG GTVEGGSSSK YSQPRRHLLT TGWSVFVSAK KLVAGDAFIF  60
LRGENGDLRV GVRRLMRQMN NMTSSVISGH SMNLGVLATA SHAISTRTRF SVFYKPRTSR  120
SEFIVSLNKY LEARNRKLSV GMRFRMMFEG EESAMYRFSG TIVGAGENSS STWPDSEWRS  180
LKVQWDEPSL VLRPDRVSPW DIEPLIAATC PMSQTQQRSK RARPPAVISS RQDLNPFGTW  240
KSPSDPPSAS SYHNPVPGPD ILQSTKPSPG NRLKKSNHNR ILLPVSSTSM YRPNFDTPAE  300
SFTHVSEKKH ASGCRLFGIE LVDHSTFGDS SQAGIGGAAV EDTHVPLDTE LEQNSEPSSC  360
NLHDLPLVTS EPDRSCLRSA QEPHKQIRSC TKVHMQGIAV GRAVDLTKLD GYDDLLKKFE  420
EIFDIKGELS GSAKKWLVVY TDNEDDMMMV GDDPWHEFFT MVKKIYIYTA EEAKKLSPKI  480
KLSLNEVKSI KRLSDAAIGA EEQSSTVGSG C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A6e-9233205183355Auxin response factor 1
4ldw_A6e-9233205183355Auxin response factor 1
4ldw_B6e-9233205183355Auxin response factor 1
4ldx_A6e-9233205183355Auxin response factor 1
4ldx_B6e-9233205183355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087626.10.0PREDICTED: auxin response factor 1-like
SwissprotQ8L7G01e-180ARFA_ARATH; Auxin response factor 1
TrEMBLA0A022R4X40.0A0A022R4X4_ERYGU; Auxin response factor
STRINGPGSC0003DMT4000533800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58381923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.30.0auxin response factor 1